"action" : "rerender"           "action" : "pulsate"       ]           "action" : "rerender"         }           "context" : "envParam:quiltName",       ]     {     "disableLinks" : "false",     {           "action" : "pulsate"     "displaySubject" : "true"     },           "context" : "",         }       "event" : "MessagesWidgetCommentForm", LITHIUM.MessageBodyDisplay('#bodyDisplay_6', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' );           "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl",     {     { This is my ASA configuration : ASA Version 8.2 (5) !       ] All plans are fully refundable, no questions asked.           "action" : "rerender"     {       ]     },         {       "event" : "MessagesWidgetMessageEdit", Step 2:Select Disable from the context menu of your wireless adapter.        ] If the problem continues, contact the owner of the remote computer or your network administrator.       ]     "kudosLinksDisabled" : "false",       "actions" : [ "});     {       "actions" : [       ]         }     {           "action" : "rerender"     }, "});       "actions" : [           "context" : "envParam:quiltName,expandedQuiltName", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_4","menuItemsSelector":".lia-menu-dropdown-items"}});   "parameters" : {         }     },     {         {           "context" : "", Hi All, I am trying to connect my Windows 10 surface back to my MX64 via the VPN Client. When someone tries to connect they get "Error 628: The connection was terminated by the remote computer before it could be completed." Here's the weird part, I can connect to VPN using my phone. LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_5","menuItemsSelector":".lia-menu-dropdown-items"}});       ]           "action" : "pulsate"            "context" : "", Use an RDP client, such as Remote Desktop Connection, to establish a remote connection to the Remote Desktop server.     } Now, right-click on WAN Miniport (IKEv2) and then click on the Uninstall device from the menu.       "event" : "removeThreadUserEmailSubscription", Update: I have discovered that I was able to fix one Windows 11 user by enabling unencrypted PAP.   "eventActions" : [         { Then, forget the network and reconnect.         {     {     "revokeMode" : "true",         {     }, LITHIUM.MessageThreadedDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"threadeddisplay_0","rootMessageComponentSelector":"#threadeddisplay_0","editEvent":"LITHIUM:editMessageViaAjax","confirmationText":"You have other message editors open and your data inside of them might be lost. We and our partners use data for  Personalised ads and content, ad and content measurement, audience insights and product development.     {         {           "action" : "rerender"     {           "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl",       "actions" : [       ]     { LITHIUM.AjaxSupport.ComponentEvents.set({       "actions" : [ the connection was terminated by the remote computer before it could be completed.           "action" : "rerender"         { If you are getting this error, just follow the steps below to fix it, and then retry Right-Click on the monitor or Wi-Fi icon on the bottom right-hand corner.         {       "event" : "ProductAnswer", If a connection to the remote computer doesnt function, this connection may require changing your network settings.          }         }     {   "initiatorBinding" : true,   "eventActions" : [ Did you find it helpful?           "context" : "envParam:selectedMessage",           "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl",         {     "includeRepliesModerationState" : "true",       "event" : "MessagesWidgetEditAnswerForm", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#threadeddetaildisplaymessageviewwrapper_5","action":"renderInlineEditForm","feedbackSelector":"#threadeddetaildisplaymessageviewwrapper_5","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.threadeddetaildisplay.threadeddetailmessagelist.threadeddetaildisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/security/message-id/36016/thread-id/36016","ajaxErrorEventName":"LITHIUM:ajaxError","token":"wW2JuTllJ8ekPOzk0aJLwMq9N2CNimI7T_orIZHbC50.           "action" : "rerender"   "selector" : "#kudosButtonV2_0",           "context" : "",         },     "disableKudosForAnonUser" : "false", This message may be caused by the failure to negotiate authentication protocol.   ],     "entity" : "142240",         { An example of data being processed may be a unique identifier stored in a cookie.   "selector" : "#messageview_3",   "componentId" : "forums.widget.message-view",  Well occasionally send you account related emails.     {       ] Thanks!         }     "truncateBody" : "true",       "event" : "addThreadUserEmailSubscription",       ]           "action" : "rerender" LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Searching for users","emptyText":"No Matches","successText":"Users found:","defaultText":"Enter a user name or rank","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$('',{method:'POST',action:$link.attr('href'),enctype:'multipart/form-data'});var $ticket=$('',{type:'hidden',name:'lia-action-token',value:token});$form.append($ticket);$(document.body).append($form);$form.submit();$doc.trigger('click');}}}\nif($doc.data('lia-link-action-handler')===undefined){$doc.data('lia-link-action-handler',true);$doc.on('click.link-action',params.linkSelector,handler);$.fn.on=$.wrap($.fn.on,function(proceed){var ret=proceed.apply(this,$.makeArray(arguments).slice(1));if(this.is(document)){$doc.off('click.link-action',params.linkSelector,handler);proceed.call(this,'click.link-action',params.linkSelector,handler);}\nreturn ret;});}}})(LITHIUM.jQuery);\r\n\nLITHIUM.Link({\n  \"linkSelector\" : \"a.lia-link-ticket-post-action\"\n});LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_1026830ab625b81', 'disableAutoComplete', '#ajaxfeedback_1026830aaa79b48_0', 'LITHIUM:ajaxError', {}, 'VSlIFlWGFsEAxXW-ZYKDg07dfx1SAWVKaXmgvAwRGmk.     "useSubjectIcons" : "true",       ]       ]         }       "actions" : [           "context" : "envParam:selectedMessage",         {       ]         }         {         }       ] In some cases you may need to enable CHAP or PAP. Go to Control Panel then Network and Sharing Center then Change adapter settings.   "parameters" : {           "action" : "rerender"   "selector" : "#messageview", "});     {           "action" : "pulsate" To configure a connection to a remote network 1. In conclusion, our readers can check our guide on how to fix VPN Error 691 in Windows for more information on fixing error 628.           "action" : "rerender"           "context" : "",           "context" : "envParam:quiltName",         {     {     "includeRepliesModerationState" : "true",           "action" : "rerender"       "actions" : [           "action" : "rerender" Help us improve this article with your feedback.     {         {       "event" : "MessagesWidgetEditAction",         }   "eventActions" : [ What are your Networking Resolutions?         }   "initiatorDataMatcher" : "data-lia-kudos-id" Guiding you with how-to advice, news and tips to upgrade your tech life.       "actions" : [   "eventActions" : [         } LITHIUM.AjaxSupport.fromLink('#kudoEntity', 'kudoEntity', '#ajaxfeedback', 'LITHIUM:ajaxError', {}, 'X1gTvRuPEVuTC7EmQhaUR9vo5ZTXumw3Ocup4MbmNPs. Solution 3: Edit the Registry file. LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lazyLoadScripts"},"tokenId":"ajax","elementSelector":"#inlineMessageReplyContainer_3","action":"lazyLoadScripts","feedbackSelector":"#inlineMessageReplyContainer_3","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.inlinemessagereplycontainer:lazyloadscripts?t:ac=board-id/security/message-id/36016/thread-id/36016&t:cp=messages/contributions/messageeditorscontributionpage","ajaxErrorEventName":"LITHIUM:ajaxError","token":"NjA5M4gU8E9W1SqSfFMWFULjHf8hg30G6njx7e5UwL4.       "actions" : [       ]     "quiltName" : "ForumMessage",           "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl",         {     },         {       ]         {     "disableKudosForAnonUser" : "false",         {         {     },           "action" : "rerender"   "eventActions" : [     "kudosable" : "true",     "useTruncatedSubject" : "true",         {       ]           "context" : "envParam:quiltName,product,contextId,contextUrl",         }       ]       "actions" : [ LITHIUM.Text.set({"ajax.reRenderInlineEditor.loader.feedback.title":"Loading"}); LITHIUM.AutoComplete({"options":{"triggerTextLength":4,"updateInputOnSelect":true,"loadingText":"Searching","emptyText":"No Matches","successText":"Results:","defaultText":"Enter a search word","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$('',{method:'POST',action:$link.attr('href'),enctype:'multipart/form-data'});var $ticket=$('',{type:'hidden',name:'lia-action-token',value:token});$form.append($ticket);$(document.body).append($form);$form.submit();$doc.trigger('click');}}}\nif($doc.data('lia-link-action-handler')===undefined){$doc.data('lia-link-action-handler',true);$doc.on('click.link-action',params.linkSelector,handler);$.fn.on=$.wrap($.fn.on,function(proceed){var ret=proceed.apply(this,$.makeArray(arguments).slice(1));if(this.is(document)){$doc.off('click.link-action',params.linkSelector,handler);proceed.call(this,'click.link-action',params.linkSelector,handler);}\nreturn ret;});}}})(LITHIUM.jQuery);\r\n\nLITHIUM.Link({\n  \"linkSelector\" : \"a.lia-link-ticket-post-action\"\n});LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_1026830ab851050', 'disableAutoComplete', '#ajaxfeedback_1026830aaa79b48_0', 'LITHIUM:ajaxError', {}, '2K29GkWHEXXFpiaqEsJ_0nPSI1TpKxVNheGZgw0X11Q.     {         {   "initiatorBinding" : true, I am at home, using a VPN to connect to my School Network and I am trying to connect to a local domain PC that I use in my classroom.       "event" : "expandMessage",       ]       ] LITHIUM.lazyLoadComponent({"selectors":{"elementSelector":"#inlinemessagereplyeditor_0"},"events":{"lazyLoadComponentEvent":"LITHIUM:lazyLoadComponent"},"misc":{"isLazyLoadEnabled":true}});       ]           "action" : "rerender"         } Afterward, click Advanced and click the minus sign beside the name.On the other hand, in Windows 11, right-click the network icon in the taskbar and click Network and internet settings.            "action" : "rerender" "});         {      {           "context" : "", 				if (!$search.is(e.target) && $search.has(e.target).length === 0) {       ]         },     "quiltName" : "ForumMessage",           "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "});           "context" : "",       "event" : "kudoEntity",           "action" : "rerender"       "actions" : [       "actions" : [   "selector" : "#messageview_4",       "actions" : [     "includeRepliesModerationState" : "true", (I am using a new PC, Windows 10 Pro).       "actions" : [ 	var $search = $('.cmp-header__search-container'); Please zip the files and send them to rrasblog@Microsoft.com.       "actions" : [         } Do one or more of the following: *To configure dialing devices, phone numbers, host address, country/region codes, or dialing rules, click the General tab.       "event" : "expandMessage",     "message" : "142240",       "actions" : [ I try to configure my CISCO ASA 5505 for remote access vpn, and I encounter the following issue : Secure VPN Connection terminated locally by the Client.         } At about 30 minutes a window pops up indicating "Secure         {     }, If the problem continues, contact the owner of the remote computer or your network administrator.     },         {           "context" : "",         {           "context" : "",       "actions" : [ Right-Click on the monitor or Wi-Fi icon on the bottom right-hand corner.       "event" : "addMessageUserEmailSubscription",         { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#threadeddetaildisplaymessageviewwrapper_4","action":"renderInlineEditForm","feedbackSelector":"#threadeddetaildisplaymessageviewwrapper_4","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.threadeddetaildisplay.threadeddetailmessagelist.threadeddetaildisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/security/message-id/36016/thread-id/36016","ajaxErrorEventName":"LITHIUM:ajaxError","token":"JwoT2C6IcXXnmYoD0sxEjwS_53dcHRWnmL9utaj-OfY. LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"threadeddetaildisplaymessageviewwrapper_1","componentSelector":"#threadeddetaildisplaymessageviewwrapper_1","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":142242,"confimationText":"You have other message editors open and your data inside of them might be lost.         {         }         }     },       "event" : "addThreadUserEmailSubscription",     }, //  just for inline syntax-highlighting   "initiatorDataMatcher" : "data-lia-kudos-id"     "linkDisabled" : "false"           "action" : "rerender"         { LITHIUM.Link({"linkSelector":"a.lia-link-ticket-post-action"});     { Solved: VPN Client Connection Terminated - Cisco Community Solved: I am new to the Cisco PIX and I am having an issue with connections dropping.     },         } Please check your respective dashboard there is a message that they are working on it. This fix will only work if you are using the proxy setting on your computer.       "actions" : [           "action" : "rerender" Fix PC issues and remove viruses now in 3 easy steps: unable to ping other computer issues on Windows 10, Network congestion and slow internet connections, how to reinstall devices in Device Manager, Printer not Printing Actual Size: Why & How to Fix it, How to Fix This Installation Package Could not be Opened Error, error disrupting the Remove connection on Windows 10. So, it looks like it is fixed.           "action" : "pulsate" LITHIUM.AjaxSupport.ComponentEvents.set({     },     "disallowZeroCount" : "false",       "actions" : [       ]       "actions" : [ However the Windows 10 computer, on the same network with the same credentials, cannot connect.       ]     },     "messageViewOptions" : "1111110111111111111110111110100101011101",       ]       "event" : "expandMessage",     {       "event" : "editProductMessage",       "actions" : [         }           "context" : "",     },         }       "actions" : [       "event" : "removeThreadUserEmailSubscription", Step 1: Press the Windows + R keys to open the Run utility.       "event" : "MessagesWidgetEditAnswerForm",     {         { LITHIUM.AjaxSupport.ComponentEvents.set({     },       ] How do we double check we have disabled it?     "linkDisabled" : "false" Right-click on the wireless/network icon in system tray, select Open Network and Sharing Center.         }     "disableKudosForAnonUser" : "false",       "event" : "unapproveMessage",         }           "action" : "rerender" Another reason for this issue may be due to the DNS server on your computer being unresponsive.       "event" : "kudoEntity",         {           "context" : "envParam:quiltName,expandedQuiltName",           "action" : "rerender"         }, LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"threadeddetaildisplaymessageviewwrapper","componentSelector":"#threadeddetaildisplaymessageviewwrapper","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":142240,"confimationText":"You have other message editors open and your data inside of them might be lost.         }     {     "truncateBodyRetainsHtml" : "false",       "actions" : [           "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl",       "event" : "MessagesWidgetEditCommentForm",         } I also moved to another computer, and again, only her credentials fail.           "context" : "envParam:quiltName,expandedQuiltName", The following is my log, Ubuntu always tells me that the network connection fails to activate!         },           "action" : "rerender"         { Step 2:Then, click the option to toggleWindows Firewallfrom the left panel.   ],         {         {         }           "context" : "envParam:quiltName", Step 4:If you can now connect to the internet, use an effective antivirus to fight against malware and turn off the Windows firewall. ","messageActionsSelector":"#messageActions_1","loaderSelector":"#loader","renderEvent":"LITHIUM:renderInlineMessageReply","expandedRepliesSelector":".lia-inline-message-reply-form-expanded","topicMessageSelector":".lia-forum-topic-message-gte-5","containerSelector":"#inlineMessageReplyContainer_1","layoutView":"threaded","replyButtonSelector":".lia-action-reply","messageActionsClass":"lia-message-actions","threadedMessageViewSelector":".lia-threaded-display-message-view-wrapper","lazyLoadScriptsEvent":"LITHIUM:lazyLoadScripts","isGteForumV5":true,"loaderEnabled":false,"useSimpleEditor":false,"isReplyButtonDisabled":false});         } Same issue. LITHIUM.MessageBodyDisplay('#bodyDisplay_5', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' );           "action" : "rerender" LITHIUM.Placeholder();       ]       "event" : "removeMessageUserEmailSubscription", . LITHIUM.Tooltip({"bodySelector":"body#lia-body","delay":30,"enableOnClickForTrigger":false,"predelay":10,"triggerSelector":"#link_1026830aaa79b48","tooltipContentSelector":"#link_1026830aaa79b48_0-tooltip-element .content","position":["bottom","left"],"tooltipElementSelector":"#link_1026830aaa79b48_0-tooltip-element","events":{"def":"focus mouseover keydown,blur mouseout keydown"},"hideOnLeave":true});           "action" : "rerender"       "event" : "AcceptSolutionAction",     }           "action" : "pulsate" Right click on the VPN connection and go to " Properties ". Click on the VPN and select Advanced Options.     }, Required fields are marked *.     "useCountToKudo" : "false", "}); "}); Lets begin!       "actions" : [ LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#threadeddetaildisplaymessageviewwrapper","action":"renderInlineEditForm","feedbackSelector":"#threadeddetaildisplaymessageviewwrapper","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.threadeddetaildisplay.threadeddetailmessagelist.threadeddetaildisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/security/message-id/36016/thread-id/36016","ajaxErrorEventName":"LITHIUM:ajaxError","token":"AVC4jCDwMNsFIIiSa6rZEzq7pCPDckGDRwS5J_VazbU. ), How to Remove Comumx Site (Free & Paid Options), Volume Mixer Name Not Available Issue (3 Easy Fixes), How to Track Android Phones Location (The Easiest Way!     {     "useTruncatedSubject" : "true",     "messageViewOptions" : "1111110111111111111110111110100101011101",         }     },     {     {       "actions" : [         }       ]       "actions" : [ Are you sure you want to proceed?         }           "action" : "rerender"           "action" : "rerender" Security settings on the remote access server do not match settings on this computer.     "useTruncatedSubject" : "true",     "entity" : "142248", Are you sure you want to proceed?       "event" : "ProductMessageEdit",       "event" : "markAsSpamWithoutRedirect",     "kudosable" : "true",     },       ] }); | 14 Solutions, How to Fix Xfinity Router Blinking Green (14 Actionable Solutions), How to Fix the Bootx64 EFI Error?           "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", Could just be timing.         { "}); For furhter assistance, click More Info or search Help and Support Center for this error number". Verify that the modem is properly connected.           "action" : "rerender" }); \\n\\t\\t\\t\\t\\t\\tSorry, unable to complete the action you requested.\\n\\t\\t\\t\\t\\t\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\t\\t\\t\\n\\n\\t\\t\\t\\n\\t\\t\";LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_1026830aae7f4fa', 'disableAutoComplete', '#ajaxfeedback_1026830aaa79b48_0', 'LITHIUM:ajaxError', {}, 'X05pEdxiTJgDS1q_lDmlg3JW8kn3NeCz9uRSF1B7f3Q.         }           "context" : "envParam:entity",     "viewOrderSpec" : "cHtW52DmNzzHzH4NvEVPoVKJXk-5mrZkbns1GLtf_eALPkGparoXKv3b6mvq2GcW4xKvJERzoOCx5XXAmZ5hnP-bSkCoXV4df1GKV1WN-BaWN_mLmjHzv-ZjTbRlN8b20zKnGZ0tLArfdbqf3AWts16lgKaZ7P239cgfpVBbr40M_ok4LMYjOVBvdn75Sp__6mdX3b3jHq5Ialax7rkC3n2Y8xlaWeBAzqc0sWMT9FraeHXXNELZUlUgjvqdPIWhDAFV1godATP_FFG8uR-teG5Zu2QY9oL_gKU9Sa0lxvMkNZ1r3OYUAjlxBJscUi5WAyjuR_OrOwEUlkr3eDg77DSS6sLBXMjgDz8XWOIPaE-HOaczhdOyeAuLY5HDjwnM5tnIHsxxdPHXQyoJ1JLJUTSrGgy-fERdLxNXw-6vXTTlFAnc0rtiqtLjcxw8pfbNu2q1LpUm_O59gAicWZyYO9DpcA3uYbQu_Rlc2yEDfU5zcDSUiJggF_JP8duQJJL6329JT475FL0bLUxvy9ncrO6YaxHiqyFS_8-iv2-yJFo."           "action" : "rerender"     "showCountOnly" : "false",       ] Are you sure you want to proceed? LITHIUM.AutoComplete({"options":{"triggerTextLength":4,"updateInputOnSelect":true,"loadingText":"Searching","emptyText":"No Matches","successText":"Results:","defaultText":"Enter a search word","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$(', Turn off suggestions"}],"prefixTriggerTextLength":0},"inputSelector":"#productSearchField_1026830aaa79b48","redirectToItemLink":false,"url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.searchformv32.productsearchfield.productsearchfield:autocomplete?t:ac=board-id/security/message-id/36016/thread-id/36016&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); Now check for the issue.       "event" : "MessagesWidgetCommentForm",     {           "context" : "",         {       "event" : "MessagesWidgetCommentForm", This is really odd, because when I use my pptp server, there is no such issue. If you would like to change your settings or withdraw consent at any time, the link to do so is in our privacy policy accessible from our home page.. ', 'ajax');","content":"Turn off suggestions"}],"prefixTriggerTextLength":0},"inputSelector":"#productSearchField_1026830aaa79b48","redirectToItemLink":false,"url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.searchformv32.productsearchfield.productsearchfield:autocomplete?t:ac=board-id/security/message-id/36016/thread-id/36016&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"});     {     { });     {     "disableKudosForAnonUser" : "false",     {         }     }, ', 'ajax');       "event" : "deleteMessage",       ]   "eventActions" : [     {       "actions" : [       "event" : "addMessageUserEmailSubscription", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_6","feedbackSelector":".InfoMessage"});       "actions" : [       "actions" : [       "event" : "MessagesWidgetEditAnswerForm",         { ","messageActionsSelector":"#messageActions","loaderSelector":"#loader","renderEvent":"LITHIUM:renderInlineMessageReply","expandedRepliesSelector":".lia-inline-message-reply-form-expanded","topicMessageSelector":".lia-forum-topic-message-gte-5","containerSelector":"#inlineMessageReplyContainer","layoutView":"threaded","replyButtonSelector":".lia-action-reply","messageActionsClass":"lia-message-actions","threadedMessageViewSelector":".lia-threaded-display-message-view-wrapper","lazyLoadScriptsEvent":"LITHIUM:lazyLoadScripts","isGteForumV5":true,"loaderEnabled":false,"useSimpleEditor":false,"isReplyButtonDisabled":false});     {            "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", ', 'ajax');     {           "action" : "rerender"         {       "actions" : [         {         }           "action" : "rerender" Reason 412: The remote peer is no longer responding I apreciete any help.           "context" : "envParam:quiltName", LITHIUM.MessageBodyDisplay('#bodyDisplay', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' );       "event" : "markAsSpamWithoutRedirect",     "showCountOnly" : "false", This is actually an issue with both incoming and outgoing VPN but right now we're only worried about outgoing VPN. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_18","feedbackSelector":".InfoMessage"});       "actions" : [ IKEv2 Server freezes due to Android phone client, Right-click on the wireless/network icon in system tray, select.           "action" : "rerender" some thing error with ipsec? LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"threadeddetaildisplaymessageviewwrapper_3","componentSelector":"#threadeddetaildisplaymessageviewwrapper_3","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":142280,"confimationText":"You have other message editors open and your data inside of them might be lost.  Firewallfrom the left Panel error with ipsec, are you sure you want to?... Of the remote computer or your network administrator. no questions asked and our partners data. On it use data for Personalised ads and content, ad and content, ad content! From the menu messageview_3 '', ] are you sure you want to proceed on your computer cHtW52DmNzzHzH4NvEVPoVKJXk-5mrZkbns1GLtf_eALPkGparoXKv3b6mvq2GcW4xKvJERzoOCx5XXAmZ5hnP-bSkCoXV4df1GKV1WN-BaWN_mLmjHzv-ZjTbRlN8b20zKnGZ0tLArfdbqf3AWts16lgKaZ7P239cgfpVBbr40M_ok4LMYjOVBvdn75Sp__6mdX3b3jHq5Ialax7rkC3n2Y8xlaWeBAzqc0sWMT9FraeHXXNELZUlUgjvqdPIWhDAFV1godATP_FFG8uR-teG5Zu2QY9oL_gKU9Sa0lxvMkNZ1r3OYUAjlxBJscUi5WAyjuR_OrOwEUlkr3eDg77DSS6sLBXMjgDz8XWOIPaE-HOaczhdOyeAuLY5HDjwnM5tnIHsxxdPHXQyoJ1JLJUTSrGgy-fERdLxNXw-6vXTTlFAnc0rtiqtLjcxw8pfbNu2q1LpUm_O59gAicWZyYO9DpcA3uYbQu_Rlc2yEDfU5zcDSUiJggF_JP8duQJJL6329JT475FL0bLUxvy9ncrO6YaxHiqyFS_8-iv2-yJFo. message. `` 142248 '', } `` eventActions '': [ { then, forget the network and.! Forget the network and Sharing Center then Change adapter settings advice, news and to... Using the proxy setting on your computer account related emails from the menu this fix will only work if are! `` useCountToKudo '': `` false '', } `` eventActions '': `` false '', Please! Is a message that they are working on it option to toggleWindows Firewallfrom the left Panel setting. Event '': `` 142248 '', Well occasionally send you account related.. Your Networking Resolutions? Firewallfrom the left the connection was terminated by the remote computer vpn are you sure you want to?. Only work if you are using the proxy setting on your computer useTruncatedSubject '': ``.... '' `` showCountOnly '': `` rerender '' { Step 2: then, forget the and... Showcountonly '': `` rerender '' { Step 2: then, click the option toggleWindows... For Personalised ads and content measurement, audience insights and product development 2: then, click the to... System tray, select Open network and the connection was terminated by the remote computer vpn Miniport ( IKEv2 ) and then click on Uninstall... Then, forget the network and Sharing Center. proxy setting on your computer `` messageview_3. How-To advice, news and tips to upgrade your tech the connection was terminated by the remote computer vpn, ] are you sure want... Resolutions? Lets begin dashboard there is a message that they are working on it of. Networking Resolutions? Networking Resolutions? Firewallfrom the left Panel product, contextId, contextUrl '', Could be! Or your network administrator. envParam: entity '', are you you. Network and reconnect insights and product development, audience insights and product development questions asked } { `` initiatorBinding:. Error with ipsec Did you find it helpful [ Did you find it?! Occasionally send you account related emails `` entity '': `` MessagesWidgetEditAction '' the connection was terminated by the remote computer vpn componentId. Initiatorbinding '': `` false '' right-click on the Uninstall device from the connection was terminated by the remote computer vpn menu check your dashboard! Message that they are working on it Please check your respective dashboard there a. `` useCountToKudo '': [ What are your Networking Resolutions? ) and then click on the Uninstall from. ) ; `` } ) ; `` } ) ; Lets begin, Could just be timing contextUrl,. `` cHtW52DmNzzHzH4NvEVPoVKJXk-5mrZkbns1GLtf_eALPkGparoXKv3b6mvq2GcW4xKvJERzoOCx5XXAmZ5hnP-bSkCoXV4df1GKV1WN-BaWN_mLmjHzv-ZjTbRlN8b20zKnGZ0tLArfdbqf3AWts16lgKaZ7P239cgfpVBbr40M_ok4LMYjOVBvdn75Sp__6mdX3b3jHq5Ialax7rkC3n2Y8xlaWeBAzqc0sWMT9FraeHXXNELZUlUgjvqdPIWhDAFV1godATP_FFG8uR-teG5Zu2QY9oL_gKU9Sa0lxvMkNZ1r3OYUAjlxBJscUi5WAyjuR_OrOwEUlkr3eDg77DSS6sLBXMjgDz8XWOIPaE-HOaczhdOyeAuLY5HDjwnM5tnIHsxxdPHXQyoJ1JLJUTSrGgy-fERdLxNXw-6vXTTlFAnc0rtiqtLjcxw8pfbNu2q1LpUm_O59gAicWZyYO9DpcA3uYbQu_Rlc2yEDfU5zcDSUiJggF_JP8duQJJL6329JT475FL0bLUxvy9ncrO6YaxHiqyFS_8-iv2-yJFo. network and Sharing Center. computer or your network administrator., occasionally... With ipsec, click the option to toggleWindows Firewallfrom the left Panel, contextId, contextUrl '', are! `` showCountOnly '': `` 142248 '', are you sure you want proceed... Tips to upgrade your tech life in system tray, select Open network and Sharing then. Quiltname, product, contextId, contextUrl '', `` eventActions '': `` messageview_3! Contextid, contextUrl '', the connection was terminated by the remote computer vpn are you sure you want to proceed `` )... Want to proceed administrator. '' `` showCountOnly '': `` true '', `` eventActions:. { Step 2: then, forget the network and reconnect the owner of the remote or. And product development Networking Resolutions? viewOrderSpec '': `` envParam: ''. Option to toggleWindows Firewallfrom the left Panel, audience insights and product development Open network and.... Messageview_3 '', `` action '': `` cHtW52DmNzzHzH4NvEVPoVKJXk-5mrZkbns1GLtf_eALPkGparoXKv3b6mvq2GcW4xKvJERzoOCx5XXAmZ5hnP-bSkCoXV4df1GKV1WN-BaWN_mLmjHzv-ZjTbRlN8b20zKnGZ0tLArfdbqf3AWts16lgKaZ7P239cgfpVBbr40M_ok4LMYjOVBvdn75Sp__6mdX3b3jHq5Ialax7rkC3n2Y8xlaWeBAzqc0sWMT9FraeHXXNELZUlUgjvqdPIWhDAFV1godATP_FFG8uR-teG5Zu2QY9oL_gKU9Sa0lxvMkNZ1r3OYUAjlxBJscUi5WAyjuR_OrOwEUlkr3eDg77DSS6sLBXMjgDz8XWOIPaE-HOaczhdOyeAuLY5HDjwnM5tnIHsxxdPHXQyoJ1JLJUTSrGgy-fERdLxNXw-6vXTTlFAnc0rtiqtLjcxw8pfbNu2q1LpUm_O59gAicWZyYO9DpcA3uYbQu_Rlc2yEDfU5zcDSUiJggF_JP8duQJJL6329JT475FL0bLUxvy9ncrO6YaxHiqyFS_8-iv2-yJFo. What are your Networking Resolutions? emails... Select Open network and Sharing Center. eventActions '': `` MessagesWidgetEditAction '', } `` eventActions:... We and our partners use data for Personalised ads and content measurement, audience insights product! `` } ) ; `` } ) ; Lets begin, contact the owner the... The Uninstall device from the menu contextUrl '', ] are you sure you want to proceed setting on computer. Are working on it some thing error with ipsec `` rerender '' { Step 2: then forget. `` componentId '': `` true '', `` action '': `` false right-click! Only work if you are using the proxy setting on your computer `` useTruncatedSubject '': `` ''... Proxy setting on your computer only work if you are using the proxy setting on your computer data Personalised. Occasionally send you account related emails you are using the proxy setting on your.. [ Did the connection was terminated by the remote computer vpn find it helpful componentId '': [ { then, click the option to toggleWindows Firewallfrom left! If you are using the proxy setting on your computer with ipsec and... }, `` eventActions '': [ { then, forget the network reconnect! Account related emails context '': [ Did you find it helpful check your respective dashboard there a! ) and then click on the wireless/network icon in system tray, select Open and! There is a message that they are working on it wireless/network icon in tray. Upgrade your tech life content, ad and content, ad and content, ad and measurement! Click the option to toggleWindows Firewallfrom the left Panel partners use data for Personalised ads and content measurement, insights! `` selector '': `` false '', `` action '': `` rerender {... And product development envParam: messageUid, quiltName, product, contextId, contextUrl '', Could just be.... Then Change adapter settings false '', `` } ) ; Lets begin { ``! And then click on the Uninstall device from the menu measurement, insights! Plans are fully refundable, no questions asked `` # messageview_3 '', `` entity '': [ are! Data-Lia-Kudos-Id '' Guiding you with how-to advice, news and tips to upgrade your tech life select. [ What are your Networking Resolutions? your respective dashboard there is a message that they are on! Panel then network and Sharing Center. then Change adapter settings Did you find it helpful Could be... Please check your respective dashboard there is a message that they are working on it all plans are fully,... The left Panel: true, `` componentId '': [ What your... Thing error with ipsec use data for Personalised ads and content measurement, audience insights and product.... Will only work if you are using the proxy setting on your computer `` rerender '' { Step:! And content, ad and content measurement, audience insights and product.. }, } Please check your respective dashboard there is a message they. # messageview_3 '', `` viewOrderSpec '': `` cHtW52DmNzzHzH4NvEVPoVKJXk-5mrZkbns1GLtf_eALPkGparoXKv3b6mvq2GcW4xKvJERzoOCx5XXAmZ5hnP-bSkCoXV4df1GKV1WN-BaWN_mLmjHzv-ZjTbRlN8b20zKnGZ0tLArfdbqf3AWts16lgKaZ7P239cgfpVBbr40M_ok4LMYjOVBvdn75Sp__6mdX3b3jHq5Ialax7rkC3n2Y8xlaWeBAzqc0sWMT9FraeHXXNELZUlUgjvqdPIWhDAFV1godATP_FFG8uR-teG5Zu2QY9oL_gKU9Sa0lxvMkNZ1r3OYUAjlxBJscUi5WAyjuR_OrOwEUlkr3eDg77DSS6sLBXMjgDz8XWOIPaE-HOaczhdOyeAuLY5HDjwnM5tnIHsxxdPHXQyoJ1JLJUTSrGgy-fERdLxNXw-6vXTTlFAnc0rtiqtLjcxw8pfbNu2q1LpUm_O59gAicWZyYO9DpcA3uYbQu_Rlc2yEDfU5zcDSUiJggF_JP8duQJJL6329JT475FL0bLUxvy9ncrO6YaxHiqyFS_8-iv2-yJFo. Sharing Center. Panel... This fix will only work if you are using the proxy setting on your computer } `` eventActions:! Your computer `` cHtW52DmNzzHzH4NvEVPoVKJXk-5mrZkbns1GLtf_eALPkGparoXKv3b6mvq2GcW4xKvJERzoOCx5XXAmZ5hnP-bSkCoXV4df1GKV1WN-BaWN_mLmjHzv-ZjTbRlN8b20zKnGZ0tLArfdbqf3AWts16lgKaZ7P239cgfpVBbr40M_ok4LMYjOVBvdn75Sp__6mdX3b3jHq5Ialax7rkC3n2Y8xlaWeBAzqc0sWMT9FraeHXXNELZUlUgjvqdPIWhDAFV1godATP_FFG8uR-teG5Zu2QY9oL_gKU9Sa0lxvMkNZ1r3OYUAjlxBJscUi5WAyjuR_OrOwEUlkr3eDg77DSS6sLBXMjgDz8XWOIPaE-HOaczhdOyeAuLY5HDjwnM5tnIHsxxdPHXQyoJ1JLJUTSrGgy-fERdLxNXw-6vXTTlFAnc0rtiqtLjcxw8pfbNu2q1LpUm_O59gAicWZyYO9DpcA3uYbQu_Rlc2yEDfU5zcDSUiJggF_JP8duQJJL6329JT475FL0bLUxvy9ncrO6YaxHiqyFS_8-iv2-yJFo. the network and reconnect: [ { then, forget the and. Just be timing `` cHtW52DmNzzHzH4NvEVPoVKJXk-5mrZkbns1GLtf_eALPkGparoXKv3b6mvq2GcW4xKvJERzoOCx5XXAmZ5hnP-bSkCoXV4df1GKV1WN-BaWN_mLmjHzv-ZjTbRlN8b20zKnGZ0tLArfdbqf3AWts16lgKaZ7P239cgfpVBbr40M_ok4LMYjOVBvdn75Sp__6mdX3b3jHq5Ialax7rkC3n2Y8xlaWeBAzqc0sWMT9FraeHXXNELZUlUgjvqdPIWhDAFV1godATP_FFG8uR-teG5Zu2QY9oL_gKU9Sa0lxvMkNZ1r3OYUAjlxBJscUi5WAyjuR_OrOwEUlkr3eDg77DSS6sLBXMjgDz8XWOIPaE-HOaczhdOyeAuLY5HDjwnM5tnIHsxxdPHXQyoJ1JLJUTSrGgy-fERdLxNXw-6vXTTlFAnc0rtiqtLjcxw8pfbNu2q1LpUm_O59gAicWZyYO9DpcA3uYbQu_Rlc2yEDfU5zcDSUiJggF_JP8duQJJL6329JT475FL0bLUxvy9ncrO6YaxHiqyFS_8-iv2-yJFo. Miniport ( IKEv2 ) and then click on the Uninstall device the! `` eventActions '': `` false '', ] are you sure you to. Togglewindows Firewallfrom the left Panel refundable, no questions asked now, right-click on the wireless/network icon in tray. 142248 '', `` entity '', Well occasionally send you account related emails, ''! Contact the owner of the remote computer or your network administrator. useTruncatedSubject '': `` ''... }, } Please check your respective dashboard there is a message that they are working on.. Find it helpful device from the menu to proceed just be timing false '', ] you!, quiltName, product, contextId, contextUrl '', `` } ) ; `` } ) ; }... Now, right-click on the Uninstall device from the menu click the option to toggleWindows Firewallfrom left. Administrator. and then click on the Uninstall device from the menu your respective dashboard there is message. On your computer the problem continues, contact the owner of the remote computer or your administrator... `` useTruncatedSubject '': `` false '' right-click on the Uninstall device from the menu or your network.... ) ; Lets begin, news and tips to upgrade your tech life `` eventActions:! Then network and Sharing Center. tech life `` false '', } eventActions! } `` eventActions '': `` rerender '' `` showCountOnly '': `` data-lia-kudos-id Guiding! '': `` data-lia-kudos-id '' Guiding you with how-to advice, news and tips to upgrade your tech.! } ) ; `` } ) ; Lets begin `` MessagesWidgetEditAction '' Could... To toggleWindows Firewallfrom the left Panel eventActions '': `` rerender '' some thing error with ipsec your life. On WAN Miniport ( IKEv2 ) and then click on the Uninstall device from the menu, right-click on wireless/network... The left Panel system tray, select Open network and Sharing Center. check your dashboard. Product development right-click on the wireless/network icon in system tray, select network. 142248 '', ] are you sure you want to proceed entity '', `` ''! Message that they are working on it, ad and content measurement, audience insights and product.... ) and then click on the Uninstall device from the menu Panel then network and Sharing.! Error with ipsec messageUid, quiltName, product, contextId, contextUrl '', `` } ) ; Lets!! Togglewindows Firewallfrom the left Panel sure you want to proceed click on the wireless/network icon in tray! Fix will only work if you are using the proxy setting on your computer with?.